PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G31650.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 961aa    MW: 104448 Da    PI: 9.2577
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G31650.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.4e-1864110148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  LPERR01G31650.2  64 KGGWTPEEDETLRKAVEAYKGRSWKKIAECFP-YRTEVQCLHRWQKVL 110
                      688*****************************.************986 PP

2Myb_DNA-binding60.63.4e-19116162148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++vk++G+  W+ Ia+ ++ gR +kqc++rw+++l
  LPERR01G31650.2 116 KGPWTQEEDDQIIELVKKYGPTKWSVIAKALP-GRIGKQCRERWHNHL 162
                      79******************************.*************97 PP

3Myb_DNA-binding56.65.8e-18168211146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT+eE++ l++a++ +G++ W+ Ia+ ++ gRt++++k++w++
  LPERR01G31650.2 168 KDAWTAEEELALINAHQVYGNK-WAEIAKVLP-GRTDNSIKNHWNS 211
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.61459110IPR017930Myb domain
SMARTSM007174.6E-1663112IPR001005SANT/Myb domain
PfamPF002499.8E-1664110IPR001005SANT/Myb domain
SuperFamilySSF466892.58E-1565120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-2366126IPR009057Homeodomain-like
CDDcd001674.38E-1467110No hitNo description
PROSITE profilePS5129432.103111166IPR017930Myb domain
SuperFamilySSF466893.41E-32113209IPR009057Homeodomain-like
SMARTSM007173.2E-19115164IPR001005SANT/Myb domain
PfamPF002492.1E-18116162IPR001005SANT/Myb domain
CDDcd001671.68E-16118162No hitNo description
Gene3DG3DSA:1.10.10.601.1E-26127170IPR009057Homeodomain-like
SMARTSM007171.9E-17167215IPR001005SANT/Myb domain
PROSITE profilePS5129422.905167217IPR017930Myb domain
PfamPF002493.9E-16168211IPR001005SANT/Myb domain
CDDcd001671.15E-13170213No hitNo description
Gene3DG3DSA:1.10.10.603.8E-23171217IPR009057Homeodomain-like
SuperFamilySSF513512.49E-91706953IPR000652Triosephosphate isomerase
HamapMF_00147_B35.767710956IPR022896Triosephosphate isomerase, bacterial/eukaryotic
Gene3DG3DSA:3.20.20.709.2E-103710955IPR013785Aldolase-type TIM barrel
PROSITE profilePS5144081.338711954IPR000652Triosephosphate isomerase
CDDcd003114.12E-113712953IPR000652Triosephosphate isomerase
PfamPF001211.6E-85713952IPR000652Triosephosphate isomerase
TIGRFAMsTIGR004196.0E-89713947IPR000652Triosephosphate isomerase
PROSITE patternPS001710871881IPR020861Triosephosphate isomerase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006096Biological Processglycolytic process
GO:0003677Molecular FunctionDNA binding
GO:0004807Molecular Functiontriose-phosphate isomerase activity
Sequence ? help Back to Top
Protein Sequence    Length: 961 aa     Download sequence    Send to blast
MGAMAMVEQE GCVENRQPLA ASSSSVSEGS SYGGGIAQMS PPVSSSANSI SGLRRTSGPI  60
RRAKGGWTPE EDETLRKAVE AYKGRSWKKI AECFPYRTEV QCLHRWQKVL NPELIKGPWT  120
QEEDDQIIEL VKKYGPTKWS VIAKALPGRI GKQCRERWHN HLNPEIRKDA WTAEEELALI  180
NAHQVYGNKW AEIAKVLPGR TDNSIKNHWN SSLRKKLDIY SSTMSVQKSL VHDKFKDKPK  240
AVATEGHLDL NKAPIISSKD QPGTAHRSNS SGLRSVSTLP TAQPLTSHEA SIVDDSAVTL  300
VAQALGSSSV HDKGLQINST PDPMGNSGII QLEGTPAKGE PELSLKNEAR STLGPLCYQI  360
PNMEDVAPVN SSLFSERPSA NHPPEHCEDG ISSPIGCITP PPTKEKISSQ LSVDSILRSA  420
ANSFRDTPSI LRRRKRDKST PVSASELKTS GANTDSFYTP TGMGLATPTP ESFKTSSFLS  480
LGSLDGLPTS VRSFDVSPQY QARSKRMAVT KTVEKQLDFS SDGPDTCGSE ILNSPCQNSQ  540
STLSISEAPK LKENELGEHV VQLENLTKNF AHTTNLDHTL NKAVRITRKG GEAYDVSPSL  600
FVIGSSRIDE RPKPNPVWCG SESIGGFSGL RLPIGARGIR KPQPKTSFFR PKKVCHVFPS  660
SPSTPPRFNR PISNPTQHTH ARSIAFASAP RRRLHRRRLL ISSHRSMAPR KFFIGGNWKC  720
NGTSDDVKKI VTVLNEAEVP SEDVVEVVVS PPFVFLPQVK GLLRPDFSVA AQNCWVRKGG  780
AFTGEISAEM LVNLQVPWVI LGHSERRALL GESNDFVADK VAYALSQGIK VIACIGETLE  840
QREAGTTMEV VAAQTKAIAE KISDWTNVVL AYEPVWAIGT GKVATPAQAQ EVHDGLRKWL  900
ESNVSPAVAE STRIIYGGSV NGANCKELAA KPDVDGFLVG GASLKPEFVE IIKSATVKSS  960
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4obt_A1e-1437109616257Triosephosphate isomerase, cytosolic
4obt_B1e-1437109616257Triosephosphate isomerase, cytosolic
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1432437RRKRDK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0598050.0AK059805.1 Oryza sativa Japonica Group cDNA clone:006-204-G07, full insert sequence.
GenBankAK0993100.0AK099310.1 Oryza sativa Japonica Group cDNA clone:J023143L20, full insert sequence.
GenBankAK1007080.0AK100708.1 Oryza sativa Japonica Group cDNA clone:J023115C24, full insert sequence.
GenBankAK1040170.0AK104017.1 Oryza sativa Japonica Group cDNA clone:001-007-G07, full insert sequence.
GenBankJQ6502580.0JQ650258.1 Oryza sativa Indica Group triosephosphate isomerase (TPI) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644989.10.0PREDICTED: myb-related protein B
TrEMBLA0A0D9V7M90.0A0A0D9V7M9_9ORYZ; Uncharacterized protein
STRINGOB01G45570.10.0(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-111myb domain protein 3r-5